PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0005200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 1030aa    MW: 113113 Da    PI: 6.0238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0005200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-1586127143
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      +g+W++eEd  +++ v+++G++ W+tIa+ ++ gR +kqc++r
   Spipo5G0005200  86 KGPWSKEEDNMIIEMVNKHGPKKWSTIAQALP-GRIGKQCRER 127
                      79******************************.********98 PP

2Myb_DNA-binding45.71.5e-14171213145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W++eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
   Spipo5G0005200 171 KEAWSQEEELSLIRAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 213
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.7283480IPR017877Myb-like domain
SMARTSM007170.883882IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-104088IPR009057Homeodomain-like
CDDcd001670.001764280No hitNo description
PROSITE profilePS5129423.74681136IPR017930Myb domain
SuperFamilySSF466894.77E-2483133IPR009057Homeodomain-like
SMARTSM007172.3E-1385134IPR001005SANT/Myb domain
PfamPF002493.1E-1486127IPR001005SANT/Myb domain
CDDcd001675.38E-1388127No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2389127IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-21161220IPR009057Homeodomain-like
PROSITE profilePS5129422.203166220IPR017930Myb domain
SuperFamilySSF466894.77E-24167212IPR009057Homeodomain-like
SMARTSM007179.1E-14170218IPR001005SANT/Myb domain
PfamPF002497.3E-13171214IPR001005SANT/Myb domain
CDDcd001671.41E-10173213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1030 aa     Download sequence    Send to blast
MGSGEMTGGA ASHEESNVRC QKPRPFRGRT SGPTRRSTKG HWTPEEFDAK ATHLIRRKNL  60
SECFKDRTDV QCLHRWQKVL NPELVKGPWS KEEDNMIIEM VNKHGPKKWS TIAQALPGRI  120
GKQCRERSRV RVKTTWKSLN ISDCNILEEY LVVLGHLRLQ WHNHLNPAIN KEAWSQEEEL  180
SLIRAHQIYG NKWAELTKFL PGRTDNAIKN HWNSSVKRKM ESYIASGLLG EVQGLSQIEC  240
SNECVSASSA KKQESCSEGA LNDGVESVEA SECSERSARL GCGLLDSEET AESPTFTDRH  300
NRVGENTCEI KVENPHSAFS YKEYYASSCA RGMQYSTRMV EELSAEDILP DPCITGYEPD  360
QSGSQDLSRM STRQEAEVSP RVSRTLKLYA LQFGEAREYS NTVSFLDSVL DTSICLEKDS  420
DICDKQDQLT SEVDCQNKNL VEASSHLASS MGAYYSGSNN ICLNCPAGSR NCQFNGQSGG  480
TYDGLCNLVS SLDMLSIPCS QSILSEVPIP IVRPINGREA SAKDLEDDGR SPEAGGVVNS  540
ASGFSHTRRT AIPCGFTQKY SSGENCEDEV DSTVNTMKVI SVSSQDINGL RSSSGEKQST  600
PREDQHLGTS FDEQPGFPKQ EVPFVSCDLM SSRHEQQSYS PLGVRQLMIP STSCLTPYKL  660
WDSPSSDDSP DAVIKSAAKS FLYTPSIMKK RQRELLSPLH KQRNNKKSGK ESRHELGTSS  720
VKENGCFQMD VMSDENGSCV ASFSSTSRTI FSSSCYQKNN PVAFPDKKKN LVDGVGKDGS  780
QVLGTIEMIS NNNQRKREPV GHDLDGRKGI NVDKGSDTGG ILVEHSINDM QFFQSCDENI  840
DISLKMAVAE NLIGVYRRFM STPGIKRGIE SPSAWKSPWF MTTLLPGSKF ERYGCFMSPR  900
DRALDAVDLM RMLNEPDGAA PAEAHGASPR GSVQTPSTSQ REERPSTTDQ TAGGEQENPC  960
SLPRDISLLS SRRRGVFLIS ADAAARRPGS LEEQLQAPSA ASDEGPAVDA ASPPVAKSTV  1020
DLPDLGVGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-54392206159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-54392206159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.16e-83Homeodomain-like protein